Sign In | Join Free | My newlc.com
newlc.com
Products
Search by Category

cjc dac dosage

All cjc dac dosage wholesalers & cjc dac dosage manufacturers come from members. We doesn't provide cjc dac dosage products or service, please contact them directly and verify their companies info carefully.

Total 1828 products from cjc dac dosage Manufactures & Suppliers
Wholesale CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits from china suppliers

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale CJC 1295 Without DAC 2mg Lyophilized Peptide Hormone CJC-1295 Dosage Benefits from china suppliers

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale CAS 863288-34-0 Peptides CJC 1295 DAC CJC-1295 Dosage Bodybuilding from china suppliers

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their ...

Shenzhen Ghormone Biotech Co.,Ltd
Verified Supplier

Guangdong

Wholesale Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning from china suppliers

Brand Name:HongKong Blue Universal Co., Limited.

Model Number:51753-57-2

Place of Origin:China

Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning 1.Quick Details: Contact info. ---skype: mabel_3566;Email : mabel@sinosteroids.com Product Name---Cjc - ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale Factory Price Cjc1295 Without Dac Peptide Cjc1295 Nodac for Increasing Muscle from china suppliers

Brand Name:HKYC

Model Number:Pharmaceutical Grade

Place of Origin:China

Factory Price Cjc1295 Without Dac Peptide Cjc1295 Nodac for Increasing Muscle Basic Info: Port: Hong Kong, Hong Kong Production Capacity:500kg/Month Payment Terms:T/T, Western ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss from china suppliers

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community as ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Wholesale Peptide Steroid Hormones white powder Cjc-1295 with Dac CAS 863288-34-0 for Fat Burning from china suppliers

Brand Name:YCGC

Model Number:Steroid Peptide

Place of Origin:Wuhan, Hubei, China

Peptide Steroid Hormones white powder Cjc-1295 with Dac CAS 863288-34-0 for Fat Burning Basic Info Customized: Non-Customized Purity: >98% Function: Hormones and Regulation of ...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance from china suppliers

Brand Name:Name: Cjc-1295 without Dac

Model Number:CAS No.:863288-34-0

Place of Origin:China

Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance Cjc-1295 without Dac Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Wholesale Peptide Hormones Bodybuilding Cjc-1295 Peptide Human Growth Steroid from china suppliers

Brand Name:LSW

Model Number:CAS:863288-34-0

Place of Origin:China

Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC 1295 ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Wholesale White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial from china suppliers

Brand Name:SMQ

Model Number:growth hormone peptides

Place of Origin:china

White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Wholesale White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial from china suppliers

Brand Name:Sendi

Model Number:Pharmaceutical Grade

Place of Origin:China

White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide from china suppliers

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Wholesale CJC- 1295 Growth Hormone Releasing Peptides , Fat Burning Peptides With Dac from china suppliers

Brand Name:CJC-1295 With DAC

Model Number:863288-34-0

Place of Origin:China

CJC- 1295 Growth Hormone Releasing Peptides , Fat Burning Peptides With Dac Quick Detail: Product name CJC-1295 Acetate CAS register number 863288-34-0 Molecular formula C165H271N4...

Shenzhen RuiJin Pharmaceutical Co.,Ltd
Verified Supplier

Guangdong

Wholesale Growth Hormone Peptides Cjc-1295 CAS 863288-34-0 Steroid Cjc-1295 with Dac for Muscle Enhance from china suppliers

Brand Name:HZ

Model Number:863288-34-0

Place of Origin:China

Growth Hormone Peptides Cjc-1295 CAS 863288-34-0 Steroid Cjc-1295 with Dac for Muscle Enhance 863288-34-0 CJC 1295 Peptide Human Growth CJC-1295 With Dac For Muscle Enhance Quick ...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Wholesale CAS 863288-34-0 Growth Hormone Peptides / Effective Peptide Hormones Bodybuilding CJC-1295 from china suppliers

Brand Name:Biopro

Model Number:GHP-06

Place of Origin:China

CAS 863288-34-0 Growth Hormone Peptides / Effective Peptide Hormones Bodybuilding CJC-1295 Description: First of all, DAC simply means “Drug Affinity Complex,” and ‘with DAC‘ drugs ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Wholesale 99% Healthy Anti Aging Hormones Acetate Growth Hormone CAS 863288-34-0 Releasing Hormone GHRH CJC-1295 with DAC from china suppliers

Brand Name:pharm-china

Model Number:863288-34-0

Place of Origin:China

99% Healthy Anti Aging Hormones Acetate Growth Hormone CAS 863288-34-0 Releasing Hormone GHRH CJC-1295 with DAC Basic View: CJC-1295 Acetate with DAC growth hormone releasing ...

Shanghai Yijing Pharmaceutical Co.,Ltd
Verified Supplier

Shanghai

Wholesale Injectable Human Growth Hormone Steroid CJC 1295 With DAC Peptide 863288-34-0 from china suppliers

Brand Name:GB

Place of Origin:China

Injectable Human Growth Hormone Steroid CJC 1295 With DAC Peptide 863288-34-0 Products Name CJC 1295 with DAC CAS No 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight ...

Hubei God bull Pharmaceutical Co.,Ltd
Verified Supplier

Hubei

Wholesale CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production from china suppliers

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Wholesale CJC-1295 with DAC For Fat Burning 2mg Per Vial CAS 863288-34-0 from china suppliers

Brand Name:Fulu

Model Number:863288-34-0

Place of Origin:China

CJC-1295 with DAC For Fat Burning 2mg Per Vial CAS 863288-34-0 Product Description CJC-1295 with DAC Product Description : CJC - 1295 2mg / Vial Type : Immune Function Agents Grade ...

SuZhou FuLu Biotech Co.,Ltd
Verified Supplier

Jiangsu

Wholesale 99.5% 2mg / Vial Human Growth Peptide Without DAC GHRH CAS 51753-57-2 Polypeptide Hormones For Losing Fat from china suppliers

Brand Name:Shucan

Model Number:51753-57-2

Place of Origin:China

99.5% 2mg/Vial Peptide CJC-1295 Without DAC GHRH CAS 51753-57-2 Polypeptide Hormones For Losing Fat & Healthy Care Basic View : CJC-1295 without DAC (2mg/Vial / 10vial/Kit) ...

Shanghai Shucan Industrial Co.,Ltd
Verified Supplier

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request