Sign In | Join Free | My newlc.com
newlc.com
Products
Search by Category
Home > Chemicals > Plastic Raw Materials >

Cjc 1295 Side Effects

cjc 1295 side effects

All cjc 1295 side effects wholesalers & cjc 1295 side effects manufacturers come from members. We doesn't provide cjc 1295 side effects products or service, please contact them directly and verify their companies info carefully.

Total 6471 products from cjc 1295 side effects Manufactures & Suppliers
Wholesale Healthy Cjc-1295 Dac Fat Burning Peptides White Powder With High Purity , ISO9001 Comliant from china suppliers

Brand Name:nanjian

Model Number:2mg/Vial

Place of Origin:China

fat Loss Powder Peptide China supplier Cjc-1295 DAC CJC-1295 DAC has shown some amazing results as a hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale white powder 2 mg/vial  Peptide CJC 1295 Without DAC for muscle building 863288-34-0 from china suppliers

Brand Name:JNJG

Model Number:863288-34-0

Place of Origin:CHINA

GHRH Human Growth Hormone Anabolic Steroid Peptides CJC 1295 Without DAC 2 mg/vial 863288-34-0 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; CJC-1295 Acetate;CJC1295 ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Wholesale Body Building Peptides CJC-1295 with DAC 863288-34-0 C165H271N47O46 from china suppliers

Brand Name:Pharmagrade Steroids

Model Number:863288-34-0

Place of Origin:WUHAN CHINA

Body Building Peptides CJC-1295 with DAC 863288-34-0 C165H271N47O46 CJC-1295 with DAC Unit Size 2 mg/vial Unit Quantity 1 Vial Purity :99% MF: C165H271N47O46 CAS No.: 863288-34-0 ...

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Wholesale CAS 863288-34-0 Growth Hormone Peptides / Effective Peptide Hormones Bodybuilding CJC-1295 from china suppliers

Brand Name:Biopro

Model Number:GHP-06

Place of Origin:China

CAS 863288-34-0 Growth Hormone Peptides / Effective Peptide Hormones Bodybuilding CJC-1295 Description: First of all, DAC simply means “Drug Affinity Complex,” and ‘with DAC‘ drugs ...

Biopro Chemicals Co., Ltd.
Verified Supplier

Shanghai

Wholesale 2mg / Vial Effective Peptide Hormones Bodybuilding CJC-1295 CAS 863288-34-0 from china suppliers

Brand Name:LSW

Model Number:863288-34-0

Place of Origin:China

2mg / Vial Effective Peptide Hormones Bodybuilding CJC-1295 CAS 863288-34-0 Description: First of all, DAC simply means “Drug Affinity Complex,” and ‘with DAC‘ drugs are going to ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hong Kong

Wholesale CJC 1295 Growth Hormones Peptide Modified GRF 1-29 CJC1295 W / O DAC 2mg / Vial from china suppliers

Brand Name:CJC 1295 peptides

Model Number:CJC 1295 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China CJC 1295

CJC 1295 Growth Hormones Peptide Modified GRF 1-29 CJC1295 W / O DAC 2mg / Vial Product Name CJC 1295 Also known as CJC 1295 no DAC,CJC-1295 Without DAC, CJC no DAC, Modified GRF 1...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale CJC 1295 Peptide Hormones Bodybuilding Modified GRF 1-29 CJC1295 without DAC 2mg Vial from china suppliers

Brand Name:wumeitech

Model Number:CJC 1295 vials or Modified GRF 1-29 Powder Form

Place of Origin:China

CJC 1295 Peptide Hormones Bodybuilding Modified GRF 1-29 CJC1295 without DAC 2mg Vial Product Name CJC 1295 Also known as CJC 1295 no DAC,CJC-1295 Without DAC, CJC no DAC, Modified ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Wholesale CJC-1295 Peptide Human Growth Steroid CJC1295 without DAC for Muscle Building from china suppliers

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

CJC-1295 Peptide Human Growth Steroid CJC1295 without DAC for Muscle Building CJC-1295 Without DAC CJC-1295 Without DAC Alias: CJC-1295 Acetate; CJC1295(Without DAC); CJC-1295 ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning from china suppliers

Brand Name:rina@pharmade.com

Model Number:skype: zarazhou3

Place of Origin:China

Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning Buy CJC-1295 with DAC Online from rina at pharmade dot com Density:1.45 CJC-1295 with DAC Product Description: ...

Shenzhen Shijingu Technology Co., Ltd.
Verified Supplier

Guangdong

Wholesale Human Growth Hormone CJC-1295 DAC (2mg/vial) CAS NO.863288-34-0 from china suppliers

Brand Name:Simeiquan

Model Number:863288-34-0

Place of Origin:China

Human Growth Hormone CJC-1295 DAC (2mg/vial) CAS NO.863288-34-0 for Bodybuilding Quick Details ProName: CJC-1295 DAC (2mg/vial) CasNo: 863288-34-0 Appearance: white Application: ...

Shenzhen Simeiquan Biotechnology Co., Ltd.
Verified Supplier

Guangdong

Wholesale Increase Growth Hormone Peptide Steroid Hormones CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides from china suppliers

Place of Origin:Wuhan, Hubei, China

Brand Name:YCGC

Model Number:863288-34-0

Increase Growth Hormone Peptide Steroid Hormones CJC-1295 DAC 2mg/vial 5mg/vial Purchase Peptides Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu...

Wuhan Yuancheng Gongchuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale CJC-1295 DAC Fat Loss Human Growth Hormone Muscle Gain 2 Mglvial from china suppliers

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

CJC-1295 DAC Fat Loss Human Growth Hormone Muscle Gain 2 Mglvial CJC-1295 DAC CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Wholesale Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 from china suppliers

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale High Purity CJC-1295 With DAC Peptide Hormones Bodybuilding 863288-34-0 from china suppliers

Brand Name:Guangzhou Huao

Model Number:CAS 863288-34-0

Place of Origin:Guangzhou China

Human Growth Peptides CJC-1295 with DAC 5mg 2mg Cylce for Bodybuilding CJC-1295 with --Quick Info : CJC-1295 with ​--Cas No. 863288-34-0 CJC-1295 with ​--Product Name CJC-1295 ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Wholesale High Purity Pharmaceutical Polypeptide Hormones CJC-1295 with DAC from china suppliers

Brand Name:CJC-1295 with DAC

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

High Purity Pharmaceutical Polypeptide Hormones CJC-1295 with DAC Description: CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not ...

HongKong Biosuper Health Tech. Co., Ltd
Verified Supplier

Hongkong

Wholesale Hormone Peptides CJC-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 from china suppliers

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Wholesale Bodybuilding Human Growth Hormone Peptide Cjc 1295 with Dac CAS 863288-34-0 from china suppliers

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:Wuhan

Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Wholesale High Purity Pharmaceutical Peptide Hormones Bodybuilding CJC-1295 with DAC from china suppliers

Brand Name:CJC-1295 with DAC

Model Number:5mg/vial * 10vials/kit

Place of Origin:China

Description: CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase growth hormone and ...

HongKong Amgen Biopharm CO.,LTD
Verified Supplier

Hong Kong

Wholesale CJC 1295 Without DAC Boost Protein Synthesis Muscle Building Peptides Tissue 2mg / Vial from china suppliers

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

CJC 1295 without DAC boost protein synthesis and growth of muscle tissue 2mg / vial CAS : 863288-34-0 Molar Mass: Da (g/mol) Molecular Formula: C165H269N47O46 Synonyms:MPA-Lys30,D...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Wholesale Deep Sleep Fat Loss Human Growth Hormones CJC-1295 With DAC Peptides CAS 863288-34-0 from china suppliers

Brand Name:JCJ

Model Number:CAS: 863288-34-0

Place of Origin:China

Human Growth Hormones CJC-1295 with DAC Peptides for Deep Sleep Fat Loss Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, ...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request